Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Eucalyptus globulus subsp. globulus Cytochrome b559 subunit alpha (psbE)

This Recombinant Eucalyptus globulus subsp. globulus Cytochrome b559 subunit alpha (psbE) spans the amino acid sequence from region 1-83.

Product Specifications

Product Name Alternative

Cytochrome b559 subunit alpha, PSII reaction center subunit V

UniProt

Q49KY2

Expression Region

1-83

Origin

Eucalyptus globulus subsp. globulus (Tasmanian blue gum)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSGSTGERSFADIITSIRYWVIHSITIPSLFIAGWLFVSTGLAYDVFGSPRPNEYFTESR QGIPLITGRFDPLEQLDEFSRSF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human UDP Glucose Ceramide Glucosyltransferase (UGCG), Active Protein
RPU59185-01 50 µg

Human UDP Glucose Ceramide Glucosyltransferase (UGCG), Active Protein

Sign In for Pricing
View Details
Human UDP Glucose Ceramide Glucosyltransferase (UGCG), Active Protein
RPU59185-02 100 µg

Human UDP Glucose Ceramide Glucosyltransferase (UGCG), Active Protein

Sign In for Pricing
View Details
Human UDP Glucose Ceramide Glucosyltransferase (UGCG), Active Protein
RPU59185-03 1 mg

Human UDP Glucose Ceramide Glucosyltransferase (UGCG), Active Protein

Sign In for Pricing
View Details
C21orf70 Rabbit Polyclonal Antibody (PE-Cy5.5)
orb874830 100 µL

C21orf70 Rabbit Polyclonal Antibody (PE-Cy5.5)

Sign In for Pricing
View Details
ZNF575 siRNA (m)
sc-155753 10 µM

ZNF575 siRNA (m)

Sign In for Pricing
View Details
PPLK/GFP+Puro-RHOA shRNA (3+1)
PPL00090-3 1 Each

PPLK/GFP+Puro-RHOA shRNA (3+1)

Sign In for Pricing
View Details