Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Eucalyptus globulus subsp. globulus Cytochrome b559 subunit alpha (psbE)

This Recombinant Eucalyptus globulus subsp. globulus Cytochrome b559 subunit alpha (psbE) spans the amino acid sequence from region 1-83.

Product Specifications

Product Name Alternative

Cytochrome b559 subunit alpha, PSII reaction center subunit V

UniProt

Q49KY2

Expression Region

1-83

Origin

Eucalyptus globulus subsp. globulus (Tasmanian blue gum)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSGSTGERSFADIITSIRYWVIHSITIPSLFIAGWLFVSTGLAYDVFGSPRPNEYFTESR QGIPLITGRFDPLEQLDEFSRSF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MRPS22 Antibody
OAAN02679-50UL 50 µL

MRPS22 Antibody

Sign In for Pricing
View Details
FGFR1 (pY766) Blocking Peptide
CBP1421-01 1 mg

FGFR1 (pY766) Blocking Peptide

Sign In for Pricing
View Details
FGFR1 (pY766) Blocking Peptide
CBP1421-02 5 mg

FGFR1 (pY766) Blocking Peptide

Sign In for Pricing
View Details
SIRP-α1/β1 Polyclonal Antibody
E20-75624 100 µg

SIRP-α1/β1 Polyclonal Antibody

Sign In for Pricing
View Details
Reagecon 400 μS/cm Conductivity Standard at 25°C
CSKC400-5L 5 L

Reagecon 400 μS/cm Conductivity Standard at 25°C

Sign In for Pricing
View Details
Mpdu1 sgRNA CRISPR Lentivector (Rat) (Target 1)
K6170602 1.0 µg DNA

Mpdu1 sgRNA CRISPR Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details