Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Eucalyptus globulus subsp. globulus Cytochrome b559 subunit alpha (psbE)

This Recombinant Eucalyptus globulus subsp. globulus Cytochrome b559 subunit alpha (psbE) spans the amino acid sequence from region 1-83.

Product Specifications

Product Name Alternative

Cytochrome b559 subunit alpha, PSII reaction center subunit V

UniProt

Q49KY2

Expression Region

1-83

Origin

Eucalyptus globulus subsp. globulus (Tasmanian blue gum)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSGSTGERSFADIITSIRYWVIHSITIPSLFIAGWLFVSTGLAYDVFGSPRPNEYFTESR QGIPLITGRFDPLEQLDEFSRSF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C10orf32 siRNA (Human)
orb1853653-01 15 nmol

C10orf32 siRNA (Human)

Sign In for Pricing
View Details
C10orf32 siRNA (Human)
orb1853653-02 30 nmol

C10orf32 siRNA (Human)

Sign In for Pricing
View Details
Human MOCO Sulphurase C-Terminal Domain Containing Protein 1 (MOSC1) ELISA Kit
EKN47090 96 Tests

Human MOCO Sulphurase C-Terminal Domain Containing Protein 1 (MOSC1) ELISA Kit

Sign In for Pricing
View Details
Human ZWINT (NM_032997) AAV Particle
RC218480A1V 250 µL

Human ZWINT (NM_032997) AAV Particle

Sign In for Pricing
View Details
TATDN3 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
46219061 1.0 µg DNA

TATDN3 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
LentimiRa-Off-mmu-miR-7000-3p Vector
mm31543 500 ng

LentimiRa-Off-mmu-miR-7000-3p Vector

Sign In for Pricing
View Details