Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ1306 (MJ1306)

This Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ1306 (MJ1306) spans the amino acid sequence from region 1-83.

Product Specifications

Product Name Alternative

Uncharacterized protein MJ1306

UniProt

Q58702

Expression Region

1-83

Origin

Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLDAILSNYLYYPSILAFLFGVLMGAKYRHKIGNIFGYLILTVVIAYFLKAFPYYDLLPL SCSYLSAVIGIIIGNRLFGGKMI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HMGCL (NM_000191) Human Tagged Lenti ORF Clone
RC203817L3 10 µg

HMGCL (NM_000191) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
MOSPD3 (C-6) HRP
sc-514923 HRP 200 µg/mL

MOSPD3 (C-6) HRP

Sign In for Pricing
View Details
Recombinant Pseudomonas mendocina NADH-quinone oxidoreductase subunit N (nuoN), partial
MBS1053780-01 1 mg (E-Coli)

Recombinant Pseudomonas mendocina NADH-quinone oxidoreductase subunit N (nuoN), partial

Sign In for Pricing
View Details
Recombinant Pseudomonas mendocina NADH-quinone oxidoreductase subunit N (nuoN), partial
MBS1053780-02 1 mg (Yeast)

Recombinant Pseudomonas mendocina NADH-quinone oxidoreductase subunit N (nuoN), partial

Sign In for Pricing
View Details
HDGF shRNA (m) Lentiviral Particles
sc-45879-V 200 µL

HDGF shRNA (m) Lentiviral Particles

Sign In for Pricing
View Details
Chicken keyhole limpet hemocyanin antibody IgY (KLH-IgY) ELISA Kit
SL0187Ch-01 96 Tests

Chicken keyhole limpet hemocyanin antibody IgY (KLH-IgY) ELISA Kit

Sign In for Pricing
View Details