Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ1306 (MJ1306)

This Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ1306 (MJ1306) spans the amino acid sequence from region 1-83.

Product Specifications

Product Name Alternative

Uncharacterized protein MJ1306

UniProt

Q58702

Expression Region

1-83

Origin

Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLDAILSNYLYYPSILAFLFGVLMGAKYRHKIGNIFGYLILTVVIAYFLKAFPYYDLLPL SCSYLSAVIGIIIGNRLFGGKMI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

STAT4 Antibody
A35794-100UL 100 µL

STAT4 Antibody

Sign In for Pricing
View Details
Human VTN (Vitronectin) ELISA Kit
RE2785H-01 48 Tests

Human VTN (Vitronectin) ELISA Kit

Sign In for Pricing
View Details
Human VTN (Vitronectin) ELISA Kit
RE2785H-02 96 Tests

Human VTN (Vitronectin) ELISA Kit

Sign In for Pricing
View Details
p18 INK4c (CDKN2C) Rabbit Polyclonal Antibody
TA347988 100 µg

p18 INK4c (CDKN2C) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Rat Tinf2 Pre-designed siRNA Set B
SI214562B 1 Each

Rat Tinf2 Pre-designed siRNA Set B

Sign In for Pricing
View Details
EIF3EP3 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
LV760576 1.0 µg DNA

EIF3EP3 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details