Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ1306 (MJ1306)

This Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ1306 (MJ1306) spans the amino acid sequence from region 1-83.

Product Specifications

Product Name Alternative

Uncharacterized protein MJ1306

UniProt

Q58702

Expression Region

1-83

Origin

Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLDAILSNYLYYPSILAFLFGVLMGAKYRHKIGNIFGYLILTVVIAYFLKAFPYYDLLPL SCSYLSAVIGIIIGNRLFGGKMI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-ethyl-1-phenylbutan-1-amine
sc-342696A 1 g

2-ethyl-1-phenylbutan-1-amine

Sign In for Pricing
View Details
Recombinant Human GrpE protein homolog 1, mitochondrial (GRPEL1)
MBS1346665-01 0.02 mg (Yeast)

Recombinant Human GrpE protein homolog 1, mitochondrial (GRPEL1)

Sign In for Pricing
View Details
Recombinant Human GrpE protein homolog 1, mitochondrial (GRPEL1)
MBS1346665-02 0.1 mg (Yeast)

Recombinant Human GrpE protein homolog 1, mitochondrial (GRPEL1)

Sign In for Pricing
View Details
Recombinant Human GrpE protein homolog 1, mitochondrial (GRPEL1)
MBS1346665-03 1 mg (Yeast)

Recombinant Human GrpE protein homolog 1, mitochondrial (GRPEL1)

Sign In for Pricing
View Details
Recombinant Human GrpE protein homolog 1, mitochondrial (GRPEL1)
MBS1346665-04 5x 1 mg (Yeast)

Recombinant Human GrpE protein homolog 1, mitochondrial (GRPEL1)

Sign In for Pricing
View Details
PBX1 (pre-B-Cell Leukemia Homeobox 1, DKFZp686B09108, MGC126627) (AP) discontinued
249798-AP 100 µL

PBX1 (pre-B-Cell Leukemia Homeobox 1, DKFZp686B09108, MGC126627) (AP) discontinued

Sign In for Pricing
View Details