Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synechococcus sp. Cytochrome b559 subunit alpha (psbE)

This Recombinant Synechococcus sp. Cytochrome b559 subunit alpha (psbE) spans the amino acid sequence from region 1-83.

Product Specifications

Product Name Alternative

Cytochrome b559 subunit alpha, PSII reaction center subunit V

UniProt

Q5N556

Expression Region

1-83

Origin

Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) (Anacystis nidulans)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAGGSTGERPFTDIITSIRYWVIHSITIPALFIAGWLFVSTGLAYDAFGTPRPNEYFTQD RTEVPIVSDRYSAKQQVDRFSAK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VapC (B-9) : m-IgGκ BP-HRP Bundle
sc-523490 1 Kit

VapC (B-9) : m-IgGκ BP-HRP Bundle

Sign In for Pricing
View Details
Human HTT Knockout HEK293T cell line
GTR15418109 1 Vial

Human HTT Knockout HEK293T cell line

Sign In for Pricing
View Details
Glutamine synthetase Polyclonal Antibody, APC-Cy5.5 Conjugated
bs-4143R-APC-Cy5.5 100 µL

Glutamine synthetase Polyclonal Antibody, APC-Cy5.5 Conjugated

Sign In for Pricing
View Details
VTI1B Blocking Peptide
33R-10341 100 ug

VTI1B Blocking Peptide

Sign In for Pricing
View Details
Galnt11 (NM_144908) Mouse Tagged ORF Clone
MR209375 10 µg

Galnt11 (NM_144908) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
TIE1 Antibody
35111-01 50 µL

TIE1 Antibody

Sign In for Pricing
View Details