Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synechococcus sp. Cytochrome b559 subunit alpha (psbE)

This Recombinant Synechococcus sp. Cytochrome b559 subunit alpha (psbE) spans the amino acid sequence from region 1-83.

Product Specifications

Product Name Alternative

Cytochrome b559 subunit alpha, PSII reaction center subunit V

UniProt

Q5N556

Expression Region

1-83

Origin

Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) (Anacystis nidulans)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAGGSTGERPFTDIITSIRYWVIHSITIPALFIAGWLFVSTGLAYDAFGTPRPNEYFTQD RTEVPIVSDRYSAKQQVDRFSAK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ephrin A1 Recombinant Antibody, PerCP-Cy5.5 Conjugated
bsm-62237R-PerCP-Cy5.5 100 µL

Ephrin A1 Recombinant Antibody, PerCP-Cy5.5 Conjugated

Sign In for Pricing
View Details
HEPACAM Antibody
DF12075-01 100 µL

HEPACAM Antibody

Sign In for Pricing
View Details
HEPACAM Antibody
DF12075-02 200 µL

HEPACAM Antibody

Sign In for Pricing
View Details
Anti-RECK Antibody Picoband®, HRP Conjugate
A06439-4-HRP 100 µg/Vial

Anti-RECK Antibody Picoband®, HRP Conjugate

Sign In for Pricing
View Details
Dhx40 Rat shRNA Plasmid (Locus ID 287595)
TR700682 1 Kit

Dhx40 Rat shRNA Plasmid (Locus ID 287595)

Sign In for Pricing
View Details
Carbanilic acid, m-heptyloxy-, 2-piperidinoethyl ester, hydrochloride
orb1986300-01 100 mg

Carbanilic acid, m-heptyloxy-, 2-piperidinoethyl ester, hydrochloride

Sign In for Pricing
View Details