Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cuscuta gronovii Cytochrome b559 subunit alpha (psbE)

This Recombinant Cuscuta gronovii Cytochrome b559 subunit alpha (psbE) spans the amino acid sequence from region 2-84.

Product Specifications

Product Name Alternative

Cytochrome b559 subunit alpha, PSII reaction center subunit V

UniProt

Q8MAV7

Expression Region

2-84

Origin

Cuscuta gronovii (Common dodder)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

SGNTGERSFADIITSIRYWVIHSITIPSLFIAGWLFVSTGLAYDVFGSPRPNEYFTENQQ GIPLITGRFEPLEEQNEFSRRSQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Goat anti-Human IgG-Fc Fragment Antibody DyLight 594 Conjugated
MBS3906812-01 0.5 mg

Goat anti-Human IgG-Fc Fragment Antibody DyLight 594 Conjugated

Sign In for Pricing
View Details
Goat anti-Human IgG-Fc Fragment Antibody DyLight 594 Conjugated
MBS3906812-02 5x 0.5 mg

Goat anti-Human IgG-Fc Fragment Antibody DyLight 594 Conjugated

Sign In for Pricing
View Details
PIF1 (N) Antibody, Rabbit Polyclonal
orb387764 100 µL

PIF1 (N) Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details
LOC105369261 Mouse Monoclonal Antibody [Clone ID: SPM503]
AM50171PU-T 20 µg

LOC105369261 Mouse Monoclonal Antibody [Clone ID: SPM503]

Sign In for Pricing
View Details
Lentiviral human HCRTR1 shRNA (UAS) - Lentiviral human HCRTR1 shRNA (UAS, GFP) (25)
GTR15346415 1 Vial

Lentiviral human HCRTR1 shRNA (UAS) - Lentiviral human HCRTR1 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
Recombinant Bacillus subtilis Uncharacterized protein yqjN (yqjN), partial
MBS1017691 Inquire

Recombinant Bacillus subtilis Uncharacterized protein yqjN (yqjN), partial

Sign In for Pricing
View Details