Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Putative uncharacterized protein CXorf69 (CXorf69)

This Recombinant Human Putative uncharacterized protein CXorf69 (CXorf69) spans the amino acid sequence from region 1-83.

Product Specifications

Product Name Alternative

Putative uncharacterized protein CXorf69

UniProt

Q96HG1

Expression Region

1-83

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEALGSGHYVGGSIRSMAAAALSGLAVRLSRPQGTRGSYGAFCKTLTRTLLTFFDLAWRL RKNFFYFYILASVILNVHLQVYI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tert-Butyl (2R) -2- (hydroxymethyl) -2-methylpyrrolidine-1-carboxylate
OR1006339 500 mg

Tert-Butyl (2R) -2- (hydroxymethyl) -2-methylpyrrolidine-1-carboxylate

Sign In for Pricing
View Details
Recombinant Drosophila melanogaster Telomere-binding protein cav (cav)
MBS1283372-01 0.02 mg (E-Coli)

Recombinant Drosophila melanogaster Telomere-binding protein cav (cav)

Sign In for Pricing
View Details
Recombinant Drosophila melanogaster Telomere-binding protein cav (cav)
MBS1283372-02 0.02 mg (Yeast)

Recombinant Drosophila melanogaster Telomere-binding protein cav (cav)

Sign In for Pricing
View Details
Recombinant Drosophila melanogaster Telomere-binding protein cav (cav)
MBS1283372-03 0.1 mg (E-Coli)

Recombinant Drosophila melanogaster Telomere-binding protein cav (cav)

Sign In for Pricing
View Details
Recombinant Drosophila melanogaster Telomere-binding protein cav (cav)
MBS1283372-04 0.1 mg (Yeast)

Recombinant Drosophila melanogaster Telomere-binding protein cav (cav)

Sign In for Pricing
View Details
Recombinant Drosophila melanogaster Telomere-binding protein cav (cav)
MBS1283372-05 0.02 mg (Baculovirus)

Recombinant Drosophila melanogaster Telomere-binding protein cav (cav)

Sign In for Pricing
View Details