Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pasteurella multocida Probable oxaloacetate decarboxylase gamma chain (oadG)

This Recombinant Pasteurella multocida Probable oxaloacetate decarboxylase gamma chain (oadG) spans the amino acid sequence from region 1-83.

Product Specifications

Product Name Alternative

Probable oxaloacetate decarboxylase gamma chain, EC= 4.1.1.3

UniProt

Q9CL26

Expression Region

1-83

Origin

Pasteurella multocida (strain Pm70)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTNAELLQEGINLMFAGVGFVMLFLFILIYAIEFMSKLVNTYFPEPVKAPSTKPIQAENH DLERLRPVIVAAIAHHRRQQGLK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Ap1g2 activation kit by CRISPRa
GA200205 1 Kit

Mouse Ap1g2 activation kit by CRISPRa

Sign In for Pricing
View Details
SH2B2 Human Gene Knockout Kit (CRISPR)
KN416814 1 Kit

SH2B2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Colloidal Gold Labeled Bovine Serum Albumin, 1mL 10nm
GP-04-10 1 mL

Colloidal Gold Labeled Bovine Serum Albumin, 1mL 10nm

Sign In for Pricing
View Details
UBXN1 (NM_015853) Human Over-expression Lysate
LC402462 20 µg

UBXN1 (NM_015853) Human Over-expression Lysate

Sign In for Pricing
View Details
Cytokeratin 7 (KRT7/1198), CF640R conjugate, 0.1mg/mL
BNC401198-500 1x 500 µL

Cytokeratin 7 (KRT7/1198), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Colloidal Gold Conjugated Monoclonal Antibody to Hepatitis B Surface Antigen,  5nm
GM-47-5 1 mL

Colloidal Gold Conjugated Monoclonal Antibody to Hepatitis B Surface Antigen, 5nm

Sign In for Pricing
View Details