Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pasteurella multocida Probable oxaloacetate decarboxylase gamma chain (oadG)

This Recombinant Pasteurella multocida Probable oxaloacetate decarboxylase gamma chain (oadG) spans the amino acid sequence from region 1-83.

Product Specifications

Product Name Alternative

Probable oxaloacetate decarboxylase gamma chain, EC= 4.1.1.3

UniProt

Q9CL26

Expression Region

1-83

Origin

Pasteurella multocida (strain Pm70)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTNAELLQEGINLMFAGVGFVMLFLFILIYAIEFMSKLVNTYFPEPVKAPSTKPIQAENH DLERLRPVIVAAIAHHRRQQGLK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GPR 150 (GPR150) (NM_199243) Human Over-expression Lysate
LY403711 100 µg

GPR 150 (GPR150) (NM_199243) Human Over-expression Lysate

Sign In for Pricing
View Details
REPS2 (NM_001080975) Human Over-expression Lysate
LC421142 20 µg

REPS2 (NM_001080975) Human Over-expression Lysate

Sign In for Pricing
View Details
PLOD3 Rabbit Polyclonal Antibody
TA366694 100 µL

PLOD3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SPART (NM_015087) Human Recombinant Protein
TP307971L 1 mg

SPART (NM_015087) Human Recombinant Protein

Sign In for Pricing
View Details
Recombinant N-cadherin Antibody
RC-7105-01 50 μL

Recombinant N-cadherin Antibody

Sign In for Pricing
View Details
Recombinant N-cadherin Antibody
RC-7105-02 100 µL

Recombinant N-cadherin Antibody

Sign In for Pricing
View Details