Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Dolichol phosphate-mannose biosynthesis regulatory protein (DPM2)

This Recombinant Human Dolichol phosphate-mannose biosynthesis regulatory protein (DPM2) spans the amino acid sequence from region 2-84.

Product Specifications

Product Name Alternative

Dolichol phosphate-mannose biosynthesis regulatory protein

UniProt

O94777

Expression Region

2-84

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

ATGTDQVVGLGLVAVSLIIFTYYTAWVILLPFIDSQHVIHKYFLPRAYAVAIPLAAGLLL LLFVGLFISYVMLKTKRVTKKAQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

iGFBP Strip
INV-151 3.0 mm (single pouch) 100pouches/box

iGFBP Strip

Sign In for Pricing
View Details
MBD3L2 AAV siRNA Pooled Vector
28163161 1.0 µg

MBD3L2 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Zebrafish CDK5 Rabbit Polyclonal Antibody
orb2805328 100 µg

Zebrafish CDK5 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TBRG4 siRNA (m)
sc-154125 10 µM

TBRG4 siRNA (m)

Sign In for Pricing
View Details
Gel Running Tray 10 X 7 Cm for E12170 - ABDOS
E12172 1 Unit/Pack

Gel Running Tray 10 X 7 Cm for E12170 - ABDOS

Sign In for Pricing
View Details
Mouse Kcnb2 / Potassium voltage-gated channel subfamily B member 2 Recombinant Protein
R2325m 1 Each

Mouse Kcnb2 / Potassium voltage-gated channel subfamily B member 2 Recombinant Protein

Sign In for Pricing
View Details