Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Dolichol phosphate-mannose biosynthesis regulatory protein (DPM2)

This Recombinant Human Dolichol phosphate-mannose biosynthesis regulatory protein (DPM2) spans the amino acid sequence from region 2-84.

Product Specifications

Product Name Alternative

Dolichol phosphate-mannose biosynthesis regulatory protein

UniProt

O94777

Expression Region

2-84

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

ATGTDQVVGLGLVAVSLIIFTYYTAWVILLPFIDSQHVIHKYFLPRAYAVAIPLAAGLLL LLFVGLFISYVMLKTKRVTKKAQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal TMIGD2 Antibody (953743) [PE/Cy7]
FAB83162PECY7 0.1 mL

Mouse Monoclonal TMIGD2 Antibody (953743) [PE/Cy7]

Sign In for Pricing
View Details
Recombinant Pan troglodytes Nurim (NRM)
orb2911411-01 20 µg

Recombinant Pan troglodytes Nurim (NRM)

Sign In for Pricing
View Details
Recombinant Pan troglodytes Nurim (NRM)
orb2911411-02 100 µg

Recombinant Pan troglodytes Nurim (NRM)

Sign In for Pricing
View Details
Recombinant Human N-alpha-acetyltransferase 50 (NAA50)
CSB-EP880928HU-01 20 µg

Recombinant Human N-alpha-acetyltransferase 50 (NAA50)

Sign In for Pricing
View Details
Recombinant Human N-alpha-acetyltransferase 50 (NAA50)
CSB-EP880928HU-02 100 µg

Recombinant Human N-alpha-acetyltransferase 50 (NAA50)

Sign In for Pricing
View Details
Recombinant Human N-alpha-acetyltransferase 50 (NAA50)
CSB-EP880928HU-03 1 mg

Recombinant Human N-alpha-acetyltransferase 50 (NAA50)

Sign In for Pricing
View Details