Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Oxaloacetate decarboxylase gamma chain (oadG)

This Recombinant Oxaloacetate decarboxylase gamma chain (oadG) spans the amino acid sequence from region 1-83.

Product Specifications

Product Name Alternative

Oxaloacetate decarboxylase gamma chain, EC= 4.1.1.3

UniProt

P13155

Expression Region

1-83

Origin

Klebsiella pneumoniae

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTDNAVLLGEGFTLMCLGMGFVLVFLLLLIFAIRGMSLAVNRLFPEPPAAPKPAPAAVAP ADDFARLKPAIVAAIHHHRRLHP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Total RNA, Testis
CR562698 5 µg

Tissue Total RNA, Testis

Sign In for Pricing
View Details
ARHGEF1 Rabbit Polyclonal Antibody
TA368923 100 µL

ARHGEF1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Cyclin E (G1/S-Phase Cyclin) (CCNE1/2587), CF594 conjugate, 0.1mg/mL
BNC942587-100 1x 100 µL

Cyclin E (G1/S-Phase Cyclin) (CCNE1/2587), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PLAC9 (NM_001012973) Human Over-expression Lysate
LC422936 20 µg

PLAC9 (NM_001012973) Human Over-expression Lysate

Sign In for Pricing
View Details
Factor I (CFI) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI15H9]
TA806029AM 100 µL

Factor I (CFI) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI15H9]

Sign In for Pricing
View Details
C5L2 (C5AR2) Rabbit Polyclonal Antibody
TA372635 100 µL

C5L2 (C5AR2) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details