Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Oxaloacetate decarboxylase gamma chain (oadG)

This Recombinant Oxaloacetate decarboxylase gamma chain (oadG) spans the amino acid sequence from region 1-83.

Product Specifications

Product Name Alternative

Oxaloacetate decarboxylase gamma chain, EC= 4.1.1.3

UniProt

P13155

Expression Region

1-83

Origin

Klebsiella pneumoniae

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTDNAVLLGEGFTLMCLGMGFVLVFLLLLIFAIRGMSLAVNRLFPEPPAAPKPAPAAVAP ADDFARLKPAIVAAIHHHRRLHP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-Vinylpyridine (stabilized with 0.1% 4-tert-butylcatechol)
TRC-V487495-1G 1 g

2-Vinylpyridine (stabilized with 0.1% 4-tert-butylcatechol)

Sign In for Pricing
View Details
Allolithocholic acid
TRC-A128920-10MG 10 mg

Allolithocholic acid

Sign In for Pricing
View Details
Recombinant Rat OLR1/LOX1 Protein (His Tag)
PKSR030274 50 µg

Recombinant Rat OLR1/LOX1 Protein (His Tag)

Sign In for Pricing
View Details
Chromogranin A / CHGA (Neuroendocrine Marker) (rCHGA/798), CF647 conjugate, 0.1mg/mL
BNC471917-500 1x 500 µL

Chromogranin A / CHGA (Neuroendocrine Marker) (rCHGA/798), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Human PVRIG (C-mFc)
PKSH034019-01 10 µg

Recombinant Human PVRIG (C-mFc)

Sign In for Pricing
View Details
Recombinant Human PVRIG (C-mFc)
PKSH034019-02 50 µg

Recombinant Human PVRIG (C-mFc)

Sign In for Pricing
View Details