Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine coronavirus Envelope small membrane protein (E)

This Recombinant Bovine coronavirus Envelope small membrane protein (E) spans the amino acid sequence from region 1-84.

Product Specifications

Product Name Alternative

Envelope small membrane protein, E protein, sM protein

UniProt

P0C2Q1

Expression Region

1-84

Origin

Bovine coronavirus (strain 98TXSF-110-ENT) (BCoV-ENT) (BCV)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFMADAYFADTVWYVGQIIFIVAICLLVIIVVVAFLATFKLCIQLCGMCNTLVLSPSIYV FNRGRQFYEFYNDVKPPVLDVDDV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Glypican-3 (GPC3/863), Biotin conjugate, 0.1mg/mL
BNCB0863-500 1x 500 µL

Glypican-3 (GPC3/863), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Pdgfa (NM_008808) Mouse Tagged ORF Clone
MG201931 10 µg

Pdgfa (NM_008808) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Mouse MCP-3 Antibody Pair Set
E-KAB-0607 50 µL & 100 µg

Mouse MCP-3 Antibody Pair Set

Sign In for Pricing
View Details
Ly6k (BC049723) Mouse Tagged ORF Clone
MG201136 10 µg

Ly6k (BC049723) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
B7 H6 (NCR3LG1) Human Gene Knockout Kit (CRISPR)
KN232774BN 1 Kit

B7 H6 (NCR3LG1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Gelsolin / Actin-depolymerizing Factor (CPTC-Gelsolin-1), CF594 conjugate, 0.1mg/mL
BNC942239-100 1x 100 µL

Gelsolin / Actin-depolymerizing Factor (CPTC-Gelsolin-1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details