Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Porcine hemagglutinating encephalomyelitis virus Envelope small membrane protein (E)

This Recombinant Porcine hemagglutinating encephalomyelitis virus Envelope small membrane protein (E) spans the amino acid sequence from region 1-84.

Product Specifications

Product Name Alternative

Envelope small membrane protein, E protein, sM protein

UniProt

P0C2Q8

Expression Region

1-84

Origin

Porcine hemagglutinating encephalomyelitis virus (strain 67N) (HEV-67N)

Field of Research

Infectious Disease & Virology; Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFMADAYLADTVWYVGQIIFIVAICLLVIIVVVAFLATFKLCIQLCGMCNTLVLSPSIYV FNRGRQFYEFYNDVKPPVLDVDDV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF488A conjugate, 0.1mg/mL
BNC880679-100 1x 100 µL

CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (190-2F2.5), CF647 conjugate, 0.1mg/mL
BNC471081-100 1x 100 µL

CD45RO (190-2F2.5), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tyrosinase (T311), CF488A conjugate, 0.1mg/mL
BNC880012-500 1x 500 µL

Tyrosinase (T311), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cdk2 / p34cdc2 Serine-Threonine Kinase (AN4.3), CF488A conjugate, 0.1mg/mL
BNC882316-500 1x 500 µL

Cdk2 / p34cdc2 Serine-Threonine Kinase (AN4.3), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MiTF (Microphthalmia Transcription Factor) (D5 + MITF/915), CF640R conjugate, 0.1mg/mL
BNC400950-100 1x 100 µL

MiTF (Microphthalmia Transcription Factor) (D5 + MITF/915), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ZAP70 (ZAP70/528 + 2F3.2), CF568 conjugate, 0.1mg/mL
BNC681137-500 1x 500 µL

ZAP70 (ZAP70/528 + 2F3.2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details