Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Phaeodactylum tricornutum Cytochrome b559 subunit alpha (psbE)

This Recombinant Phaeodactylum tricornutum Cytochrome b559 subunit alpha (psbE) spans the amino acid sequence from region 1-84.

Product Specifications

Product Name Alternative

Cytochrome b559 subunit alpha, PSII reaction center subunit V

UniProt

A0T0A3

Expression Region

1-84

Origin

Phaeodactylum tricornutum (strain CCAP 1055/1)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSGGSTGERPFSDIITSVRYWIIHSITIPSLFVSGWLFVSTGLAYDVFGTPRPNEYFTQD RQQIPLVNDRFSAKQELEDLTKGL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Amplite® Fluorimetric Glutathione GSH/GSSG Ratio Assay Kit *Green Fluorescence*
10056-AAT 200 Tests

Amplite® Fluorimetric Glutathione GSH/GSSG Ratio Assay Kit *Green Fluorescence*

Sign In for Pricing
View Details
Desmin (Muscle Cell Marker) (DES/2960R), CF594 conjugate, 0.1mg/mL
BNC942960-500 1x 500 µL

Desmin (Muscle Cell Marker) (DES/2960R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Frozen Tissue Blocks, Ovary
CB602260 1 Block

Frozen Tissue Blocks, Ovary

Sign In for Pricing
View Details
Ep-CAM / CD326 (Epithelial Marker) (rMOC-31), CF488A conjugate, 0.1mg/mL
BNC881819-500 1x 500 µL

Ep-CAM / CD326 (Epithelial Marker) (rMOC-31), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cyclophilin A (PPIA) (NM_021130) Human Over-expression Lysate
LY402839 100 µg

Cyclophilin A (PPIA) (NM_021130) Human Over-expression Lysate

Sign In for Pricing
View Details
Tissue Total RNA, Lung: left upper lobe
CR566347 5 µg

Tissue Total RNA, Lung: left upper lobe

Sign In for Pricing
View Details