Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Phaeodactylum tricornutum Cytochrome b559 subunit alpha (psbE)

This Recombinant Phaeodactylum tricornutum Cytochrome b559 subunit alpha (psbE) spans the amino acid sequence from region 1-84.

Product Specifications

Product Name Alternative

Cytochrome b559 subunit alpha, PSII reaction center subunit V

UniProt

A0T0A3

Expression Region

1-84

Origin

Phaeodactylum tricornutum (strain CCAP 1055/1)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSGGSTGERPFSDIITSVRYWIIHSITIPSLFVSGWLFVSTGLAYDVFGTPRPNEYFTQD RQQIPLVNDRFSAKQELEDLTKGL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RAD21 Mouse Monoclonal Antibody [Clone ID: OTI11F10]
CF811186 100 µg

RAD21 Mouse Monoclonal Antibody [Clone ID: OTI11F10]

Sign In for Pricing
View Details
Etoxazole-d5
TRC-E936602-5MG 5 mg

Etoxazole-d5

Sign In for Pricing
View Details
IgA Secretory Component (SC05), CF594 conjugate, 0.1mg/mL
BNC940050-500 1x 500 µL

IgA Secretory Component (SC05), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SPACA5 Human Gene Knockout Kit (CRISPR)
KN424004 1 Kit

SPACA5 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mouse Cpne6 activation kit by CRISPRa
GA200857 1 Kit

Mouse Cpne6 activation kit by CRISPRa

Sign In for Pricing
View Details
LONRF1 Polyclonal Antibody
E-AB-90842-01 60 µL

LONRF1 Polyclonal Antibody

Sign In for Pricing
View Details