Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Shewanella sp. ATP synthase subunit c (atpE)

This Recombinant Shewanella sp. ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-84.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

A1RQB5

Expression Region

1-84

Origin

Shewanella sp. (strain W3-18-1)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

METVISFTAIAVAIMIGLAALGTAIGFAILGGKFLEASARQPELAPALQIKMFIVAGLLD AISMIAVGVALFFVFANPFLAQLG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NNT Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV668752 1.0 µg DNA

NNT Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
Spark NIR™ 685 anti-mouse CD25
GT00573 25 µg

Spark NIR™ 685 anti-mouse CD25

Sign In for Pricing
View Details
6- (1H-Imidazol-1-yl) nicotinonitrile
OR5977 1 Each

6- (1H-Imidazol-1-yl) nicotinonitrile

Sign In for Pricing
View Details
SPCS1 Polyclonal Antibody, Biotin Conjugated
A61119-100 100 µL

SPCS1 Polyclonal Antibody, Biotin Conjugated

Sign In for Pricing
View Details
FIGNL2 Rabbit Polyclonal Antibody (RBITC)
orb1066511 100 µL

FIGNL2 Rabbit Polyclonal Antibody (RBITC)

Sign In for Pricing
View Details
Lentiviral mouse Cntn4 shRNA (UAS) - Lentiviral mouse Cntn4 shRNA (UAS, RFP) (25)
GTR15125987 1 Vial

Lentiviral mouse Cntn4 shRNA (UAS) - Lentiviral mouse Cntn4 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details