Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Shewanella sp. ATP synthase subunit c (atpE)

This Recombinant Shewanella sp. ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-84.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

A1RQB5

Expression Region

1-84

Origin

Shewanella sp. (strain W3-18-1)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

METVISFTAIAVAIMIGLAALGTAIGFAILGGKFLEASARQPELAPALQIKMFIVAGLLD AISMIAVGVALFFVFANPFLAQLG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C17orf68 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K0319806 1.0 µg DNA

C17orf68 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Human Granulocyte Chemotactic Protein 2 CLIA Kit
MBS8425470-01 1 Kit

Human Granulocyte Chemotactic Protein 2 CLIA Kit

Sign In for Pricing
View Details
Human Granulocyte Chemotactic Protein 2 CLIA Kit
MBS8425470-02 5x 1 Kit

Human Granulocyte Chemotactic Protein 2 CLIA Kit

Sign In for Pricing
View Details
Med30 Double Nickase Plasmid (m2)
sc-427538-NIC-2 20 µg

Med30 Double Nickase Plasmid (m2)

Sign In for Pricing
View Details
Mouse Apoprotein E (APO-E) ELISA Kit
MBS3805938-01 48 Well

Mouse Apoprotein E (APO-E) ELISA Kit

Sign In for Pricing
View Details
Mouse Apoprotein E (APO-E) ELISA Kit
MBS3805938-02 96 Well

Mouse Apoprotein E (APO-E) ELISA Kit

Sign In for Pricing
View Details