Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Shewanella sp. ATP synthase subunit c (atpE)

This Recombinant Shewanella sp. ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-84.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

A1RQB5

Expression Region

1-84

Origin

Shewanella sp. (strain W3-18-1)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

METVISFTAIAVAIMIGLAALGTAIGFAILGGKFLEASARQPELAPALQIKMFIVAGLLD AISMIAVGVALFFVFANPFLAQLG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LMX1B Protein Vector (Human) (pPM-C-HA)
26921022 500 ng

LMX1B Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
F-box and leucine-rich repeat Protein 13
315469 100 µL

F-box and leucine-rich repeat Protein 13

Sign In for Pricing
View Details
SIVA1, Recombinant, Human, aa1-175, His-Tag (Apoptosis Regulatory Protein Siva Isoform 1)
218567-01 100 µg

SIVA1, Recombinant, Human, aa1-175, His-Tag (Apoptosis Regulatory Protein Siva Isoform 1)

Sign In for Pricing
View Details
SIVA1, Recombinant, Human, aa1-175, His-Tag (Apoptosis Regulatory Protein Siva Isoform 1)
218567-02 500 µg

SIVA1, Recombinant, Human, aa1-175, His-Tag (Apoptosis Regulatory Protein Siva Isoform 1)

Sign In for Pricing
View Details
Lentiviral mouse Sult2b1 shRNA (UAS) - Lentiviral mouse Sult2b1 shRNA (UAS) plasmid
GTR15228859 1 Vial

Lentiviral mouse Sult2b1 shRNA (UAS) - Lentiviral mouse Sult2b1 shRNA (UAS) plasmid

Sign In for Pricing
View Details
Recombinant Sirtuin 6 (SIRT6)
MBS2012083-01 0.01 mg

Recombinant Sirtuin 6 (SIRT6)

Sign In for Pricing
View Details