Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus Cytochrome b559 subunit alpha (psbE)

This Recombinant Prochlorococcus marinus Cytochrome b559 subunit alpha (psbE) spans the amino acid sequence from region 1-84.

Product Specifications

Product Name Alternative

Cytochrome b559 subunit alpha, PSII reaction center subunit V

UniProt

A2BP97

Expression Region

1-84

Origin

Prochlorococcus marinus (strain AS9601)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIMAAGSTGERPFFEIITSIRYWIIHAVTLPAIFIAGFLFVYTGLAYDAFGTPRPDSYFQ SSESKAPVVTQRYEAKSQLDLRTK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Resorufin alpha-D-galactopyranoside
14021-AAT 5 mg

Resorufin alpha-D-galactopyranoside

Sign In for Pricing
View Details
1,2-Bis(diphenylphosphino)ethane
TRC-B430430-25G 25 g

1,2-Bis(diphenylphosphino)ethane

Sign In for Pricing
View Details
Recombinant Human SIRP gamma/CD172g Protein (Fc Tag)
PKSH033353-01 10 µg

Recombinant Human SIRP gamma/CD172g Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Human SIRP gamma/CD172g Protein (Fc Tag)
PKSH033353-02 50 µg

Recombinant Human SIRP gamma/CD172g Protein (Fc Tag)

Sign In for Pricing
View Details
Mouse Slc1a4 activation kit by CRISPRa
GA205788 1 Kit

Mouse Slc1a4 activation kit by CRISPRa

Sign In for Pricing
View Details
LIN7 (LIN7B) Goat Polyclonal Antibody
AP31418PU-N 100 µg

LIN7 (LIN7B) Goat Polyclonal Antibody

Sign In for Pricing
View Details