Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus Cytochrome b559 subunit alpha (psbE)

This Recombinant Prochlorococcus marinus Cytochrome b559 subunit alpha (psbE) spans the amino acid sequence from region 1-84.

Product Specifications

Product Name Alternative

Cytochrome b559 subunit alpha, PSII reaction center subunit V

UniProt

A3PB19

Expression Region

1-84

Origin

Prochlorococcus marinus (strain MIT 9301)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIMAAGSTGERPFFEIITSIRYWIIHAVTLPAIFIAGFLFVYTGLAYDAFGTPRPDSYFQ SSESKAPVVTQRYEAKSQLDLRTK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-EIF2AK1 Antibody Picoband® Fluoro647 Conjugated
A05465-2-Fluoro647 100 µg/Vial

Anti-EIF2AK1 Antibody Picoband® Fluoro647 Conjugated

Sign In for Pricing
View Details
CDC45L (Cell Division Control Protein 45 Homolog, PORC-PI-1, CDC45, CDC45L2, UNQ374/PRO710) (AP) discontinued
124755-AP 100 µL

CDC45L (Cell Division Control Protein 45 Homolog, PORC-PI-1, CDC45, CDC45L2, UNQ374/PRO710) (AP) discontinued

Sign In for Pricing
View Details
Human ZNF511 qPCR Primer Pair
QH60385S 200 Tests

Human ZNF511 qPCR Primer Pair

Sign In for Pricing
View Details
PRKAR2A Conjugated Antibody
orb1616833 100 µL

PRKAR2A Conjugated Antibody

Sign In for Pricing
View Details
NMUR1 Rabbit pAb, BF488 conjugated
orb2830303 100 µL

NMUR1 Rabbit pAb, BF488 conjugated

Sign In for Pricing
View Details
Kappa Light Chain (HCAK1, Ig kappa Chain C Region, IGKC, Immunoglobulin kappa Constant Region, Immunoglobulin kappa Light Chain, Kappa 1 Immunoglobulin Light Chain, Km, MGC111575, MGC62011, MGC72072, MGC88770, MGC88771, MGC88809) (MaxLight 750) discontinued
128720-ML750 100 µL

Kappa Light Chain (HCAK1, Ig kappa Chain C Region, IGKC, Immunoglobulin kappa Constant Region, Immunoglobulin kappa Light Chain, Kappa 1 Immunoglobulin Light Chain, Km, MGC111575, MGC62011, MGC72072, MGC88770, MGC88771, MGC88809) (MaxLight 750) discontinued

Sign In for Pricing
View Details