Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus Cytochrome b559 subunit alpha (psbE)

This Recombinant Prochlorococcus marinus Cytochrome b559 subunit alpha (psbE) spans the amino acid sequence from region 1-84.

Product Specifications

Product Name Alternative

Cytochrome b559 subunit alpha, PSII reaction center subunit V

UniProt

A8G2V8

Expression Region

1-84

Origin

Prochlorococcus marinus (strain MIT 9215)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIMAAGSTGERPFFEIITSIRYWIIHAVTLPAIFIAGFLFVYTGLAYDAFGTPRPDSYFQ SSESKAPVVTQRYEAKSQLDLRTK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat CF6 (Coupling Factor 6) ValidElisa Kit
EK342615 96 Well

Rat CF6 (Coupling Factor 6) ValidElisa Kit

Sign In for Pricing
View Details
RPL11 (60S Ribosomal Protein L11, CLL-associated Antigen KW-12) (MaxLight 550)
132771-ML550 100 µL

RPL11 (60S Ribosomal Protein L11, CLL-associated Antigen KW-12) (MaxLight 550)

Sign In for Pricing
View Details
CD4 (CD4 Antigen, CD4 Molecule, CD4mut, T Cell Surface Antigen T4/Leu3, T Cell Surface Glycoprotein CD4) (PE)
367088-01 25 Tests

CD4 (CD4 Antigen, CD4 Molecule, CD4mut, T Cell Surface Antigen T4/Leu3, T Cell Surface Glycoprotein CD4) (PE)

Sign In for Pricing
View Details
CD4 (CD4 Antigen, CD4 Molecule, CD4mut, T Cell Surface Antigen T4/Leu3, T Cell Surface Glycoprotein CD4) (PE)
367088-02 100 Tests

CD4 (CD4 Antigen, CD4 Molecule, CD4mut, T Cell Surface Antigen T4/Leu3, T Cell Surface Glycoprotein CD4) (PE)

Sign In for Pricing
View Details
CD4 (CD4 Antigen, CD4 Molecule, CD4mut, T Cell Surface Antigen T4/Leu3, T Cell Surface Glycoprotein CD4) (PE)
367088-03 200 Tests

CD4 (CD4 Antigen, CD4 Molecule, CD4mut, T Cell Surface Antigen T4/Leu3, T Cell Surface Glycoprotein CD4) (PE)

Sign In for Pricing
View Details
ASK1 (Phospho-Ser83) Antibody
MBS857266-01 0.05 mg

ASK1 (Phospho-Ser83) Antibody

Sign In for Pricing
View Details