Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus Cytochrome b559 subunit alpha (psbE)

This Recombinant Prochlorococcus marinus Cytochrome b559 subunit alpha (psbE) spans the amino acid sequence from region 1-84.

Product Specifications

Product Name Alternative

Cytochrome b559 subunit alpha, PSII reaction center subunit V

UniProt

A8G2V8

Expression Region

1-84

Origin

Prochlorococcus marinus (strain MIT 9215)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIMAAGSTGERPFFEIITSIRYWIIHAVTLPAIFIAGFLFVYTGLAYDAFGTPRPDSYFQ SSESKAPVVTQRYEAKSQLDLRTK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human ZZEF1 shRNA (UAS) - Lentiviral human ZZEF1 shRNA (UAS) (100)
GTR15109170 1 Vial

Lentiviral human ZZEF1 shRNA (UAS) - Lentiviral human ZZEF1 shRNA (UAS) (100)

Sign In for Pricing
View Details
Lentiviral mouse Lpl shRNA (UAS) - Lentiviral mouseLpl shRNA (UAS, GFP) (25)
GTR15279752 1 Vial

Lentiviral mouse Lpl shRNA (UAS) - Lentiviral mouseLpl shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
Human RAVER2 Pre-designed siRNA Set A
SI013466A 1 Each

Human RAVER2 Pre-designed siRNA Set A

Sign In for Pricing
View Details
HTRA1 Polyclonal Antibody
E-AB-40659-01 50 µL

HTRA1 Polyclonal Antibody

Sign In for Pricing
View Details
HTRA1 Polyclonal Antibody
E-AB-40659-02 100 µL

HTRA1 Polyclonal Antibody

Sign In for Pricing
View Details
FITC-linked Antibody to Fatty Acid Binding Protein 7, Brain (FABP7)
MBS2017381-01 0.1 mL

FITC-linked Antibody to Fatty Acid Binding Protein 7, Brain (FABP7)

Sign In for Pricing
View Details