Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Acidithiobacillus ferrooxidans ATP synthase subunit c (atpE)

This Recombinant Acidithiobacillus ferrooxidans ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-84.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

B5ER47

Expression Region

1-84

Origin

Acidithiobacillus ferrooxidans (strain ATCC 53993) (Leptospirillum ferrooxidans (ATCC 53993) )

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDAHTIIVAATAIAVGIIFGAAGLGSAIGWGLITSKTIEGITRQPEMRPQLLVNTFIFAG LMESFPFIILAFGFWFLFANPFLG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC7A3 (NM_001048164) Human Over-expression Lysate
LY420766 100 µg

SLC7A3 (NM_001048164) Human Over-expression Lysate

Sign In for Pricing
View Details
Doxifluridine
TRC-D556750-50MG 50 mg

Doxifluridine

Sign In for Pricing
View Details
Fc epsilon RI (FCER1A) Human Gene Knockout Kit (CRISPR)
KN203321BN 1 Kit

Fc epsilon RI (FCER1A) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue Total RNA, Breast
CR560572 5 µg

Tissue Total RNA, Breast

Sign In for Pricing
View Details
HLAH Antibody
8C16165-AAT 50 µg

HLAH Antibody

Sign In for Pricing
View Details
PMVK Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2D1]
TA503448AM 100 µL

PMVK Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2D1]

Sign In for Pricing
View Details