Recombinant ATP synthase subunit c, sodium ion specific (atpE)
This Recombinant ATP synthase subunit c, sodium ion specific (atpE) spans the amino acid sequence from region 1-84.
Product Specifications
Product Name Alternative
ATP synthase subunit c, sodium ion specific, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein
UniProt
Q0ZS24
Expression Region
1-84
Origin
Clostridium paradoxum
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MERALILAASAIGAGLAMIAGIGPGIGQGFAAGKGAEAVGKQPEAQGDILRTMLLGAAVA ESTGIYALVVALILLFANPLLNLL
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
