Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pongo abelii NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 (NDUFA3)

This Recombinant Pongo abelii NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 (NDUFA3) spans the amino acid sequence from region 1-84.

Product Specifications

Product Name Alternative

NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3, Complex I-B9, CI-B9, NADH-ubiquinone oxidoreductase B9 subunit

UniProt

Q0MQ94

Expression Region

1-84

Origin

Pongo abelii (Sumatran orangutan)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAARVGAFLRNTWDKEPVLVVSFVIGGLAVILPPLSPYFKYSIMINKATPYNYPVPVRDD GNMPDMPSHPQDPQGPSLEWLKKL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TNF alpha (J2D10), CF568 conjugate, 0.1mg/mL
BNC680994-500 1x 500 µL

TNF alpha (J2D10), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45 / LCA (2B11 + PD7/26), CF405S conjugate, 0.1mg/mL
BNC040745-100 1x 100 µL

CD45 / LCA (2B11 + PD7/26), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (Fn-3), CF640R conjugate, 0.1mg/mL
BNC402848-100 1x 100 µL

Fibronectin (Fn-3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 (ICAM-3) (186-2G9), CF740 conjugate, 0.1mg/mL
BNC740178-100 1x 100 µL

CD50 (ICAM-3) (186-2G9), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD2 (LFA2/600), CF740 conjugate, 0.1mg/mL
BNC740600-100 1x 100 µL

CD2 (LFA2/600), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (AH26 + 57), CF640R conjugate, 0.1mg/mL
BNC401025-100 1x 100 µL

ACTH (Adrenocorticotrophic Hormone) (AH26 + 57), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details