Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cytochrome b559 subunit alpha (psbE)

This Recombinant Cytochrome b559 subunit alpha (psbE) spans the amino acid sequence from region 1-84.

Product Specifications

Product Name Alternative

Cytochrome b559 subunit alpha, PSII reaction center subunit V

UniProt

Q1XD96

Expression Region

1-84

Origin

Porphyra yezoensis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSGGSTGERPFSDIITSVRYWVIHSITIPALFVAGWLFVSTGLAYDVFGTPRPNEYFTQD RQQVPLVNDRFNAKQELEDLTKGI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Clorgyline HCl
329655 10.0mg

Clorgyline HCl

Sign In for Pricing
View Details
Rabbit Anti BMP2 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 1% BSA and 50% glycerol, pH7.4) (Western Blot,IHC) 120ul
IRBAMLBMP2AP111120UL 120 µL

Rabbit Anti BMP2 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 1% BSA and 50% glycerol, pH7.4) (Western Blot,IHC) 120ul

Sign In for Pricing
View Details
GNRPX Rabbit Polyclonal Antibody (BF647)
orb2382354 100 µL

GNRPX Rabbit Polyclonal Antibody (BF647)

Sign In for Pricing
View Details
CNG3 Rabbit pAb, AP conjugated
orb2873054 100 µL

CNG3 Rabbit pAb, AP conjugated

Sign In for Pricing
View Details
Atosiban
90779-69-4 Each

Atosiban

Sign In for Pricing
View Details
RCC2 (NM_018715) Human Tagged ORF Clone Lentiviral Particle
RC208811L3V 200 µL

RCC2 (NM_018715) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details