Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cytochrome b559 subunit alpha (psbE)

This Recombinant Cytochrome b559 subunit alpha (psbE) spans the amino acid sequence from region 1-84.

Product Specifications

Product Name Alternative

Cytochrome b559 subunit alpha, PSII reaction center subunit V

UniProt

Q1XD96

Expression Region

1-84

Origin

Porphyra yezoensis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSGGSTGERPFSDIITSVRYWVIHSITIPALFVAGWLFVSTGLAYDVFGTPRPNEYFTQD RQQVPLVNDRFNAKQELEDLTKGI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Syntaxin 4 (STX4) (NM_004604) Human Over-expression Lysate
LY401462 100 µg

Syntaxin 4 (STX4) (NM_004604) Human Over-expression Lysate

Sign In for Pricing
View Details
AdmiRa-hsa-mir-6745 Virus
mh1472 250 µL

AdmiRa-hsa-mir-6745 Virus

Sign In for Pricing
View Details
Lentiviral human ANKRD35 shRNA (UAS) - Lentiviral human ANKRD35 shRNA (UAS, RFP) (25)
GTR15327254 1 Vial

Lentiviral human ANKRD35 shRNA (UAS) - Lentiviral human ANKRD35 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
FLRT2 siRNA (Human)
MBS8218939-01 15 nmol

FLRT2 siRNA (Human)

Sign In for Pricing
View Details
FLRT2 siRNA (Human)
MBS8218939-02 30 nmol

FLRT2 siRNA (Human)

Sign In for Pricing
View Details
FLRT2 siRNA (Human)
MBS8218939-03 5x 30 nmol

FLRT2 siRNA (Human)

Sign In for Pricing
View Details