Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cytochrome b559 subunit alpha (psbE)

This Recombinant Cytochrome b559 subunit alpha (psbE) spans the amino acid sequence from region 1-84.

Product Specifications

Product Name Alternative

Cytochrome b559 subunit alpha, PSII reaction center subunit V

UniProt

Q1XD96

Expression Region

1-84

Origin

Porphyra yezoensis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSGGSTGERPFSDIITSVRYWVIHSITIPALFVAGWLFVSTGLAYDVFGTPRPNEYFTQD RQQVPLVNDRFNAKQELEDLTKGI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Probe qPCR Master Mix (2x), plus ROX Solution
E0421-03 1000 Reactions

Probe qPCR Master Mix (2x), plus ROX Solution

Sign In for Pricing
View Details
EGFL6 Rabbit Polyclonal Antibody
orb3068914-01 30 µL

EGFL6 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
EGFL6 Rabbit Polyclonal Antibody
orb3068914-02 50 µL

EGFL6 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
EGFL6 Rabbit Polyclonal Antibody
orb3068914-03 100 µL

EGFL6 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
EGFL6 Rabbit Polyclonal Antibody
orb3068914-04 200 µL

EGFL6 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Pseudomonas Aeruginosa rplJ Protein (aa 1-166) (strain LESB58)
VAng-Cr0658-50gEcoli 50 µg (E. coli)

Recombinant Pseudomonas Aeruginosa rplJ Protein (aa 1-166) (strain LESB58)

Sign In for Pricing
View Details