Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cytochrome b559 subunit alpha (psbE)

This Recombinant Cytochrome b559 subunit alpha (psbE) spans the amino acid sequence from region 1-84.

Product Specifications

Product Name Alternative

Cytochrome b559 subunit alpha, PSII reaction center subunit V

UniProt

Q4G380

Expression Region

1-84

Origin

Emiliania huxleyi

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSGGSTGERPFSDIITSIRYWIIHSITIPSLFVAGFLFVSTGLAYDAFGTPRPNEYFTQD RQQIPLVNDRFSAKQELEDLTKGL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Ovary: right
CS807885 5x 5 µm

Tissue FFPE Sections, Ovary: right

Sign In for Pricing
View Details
CD11c (HC1/1), CF640R conjugate, 0.1mg/mL
BNC400152-100 1x 100 µL

CD11c (HC1/1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Uncoated Human GDNF (Glial Cell Line Derived Neurotrophic Factor) ELISA Kit
E-UNEL-H0020-01 5x 96 Tests

Uncoated Human GDNF (Glial Cell Line Derived Neurotrophic Factor) ELISA Kit

Sign In for Pricing
View Details
Uncoated Human GDNF (Glial Cell Line Derived Neurotrophic Factor) ELISA Kit
E-UNEL-H0020-02 15x 96 Tests

Uncoated Human GDNF (Glial Cell Line Derived Neurotrophic Factor) ELISA Kit

Sign In for Pricing
View Details
TentaGel® S COOH
S30903.5G 5 g

TentaGel® S COOH

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS504754 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details