Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cytochrome b559 subunit alpha (psbE)

This Recombinant Cytochrome b559 subunit alpha (psbE) spans the amino acid sequence from region 1-84.

Product Specifications

Product Name Alternative

Cytochrome b559 subunit alpha, PSII reaction center subunit V

UniProt

Q4G380

Expression Region

1-84

Origin

Emiliania huxleyi

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSGGSTGERPFSDIITSIRYWIIHSITIPSLFVAGFLFVSTGLAYDAFGTPRPNEYFTQD RQQIPLVNDRFSAKQELEDLTKGL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TTF2 Human Gene Knockout Kit (CRISPR)
KN220957LP 1 Kit

TTF2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Triphenyl Phosphate-d15
TRC-T808992-2.5MG 2.5 mg

Triphenyl Phosphate-d15

Sign In for Pricing
View Details
Tas2r104 Mouse Gene Knockout Kit (CRISPR)
KN517191 1 Kit

Tas2r104 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mouse Glutamate Receptor, Ionotropic, AMPA 4 (GRIA4) ELISA Kit
RD-GRIA4-Mu-01 96 Tests

Mouse Glutamate Receptor, Ionotropic, AMPA 4 (GRIA4) ELISA Kit

Sign In for Pricing
View Details
Mouse Glutamate Receptor, Ionotropic, AMPA 4 (GRIA4) ELISA Kit
RD-GRIA4-Mu-02 48 Tests

Mouse Glutamate Receptor, Ionotropic, AMPA 4 (GRIA4) ELISA Kit

Sign In for Pricing
View Details
Tal1 (TAL1/3146), CF568 conjugate, 0.1mg/mL
BNC683146-500 1x 500 µL

Tal1 (TAL1/3146), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details