Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanocaldococcus jannaschii Tetrahydromethanopterin S-methyltransferase subunit G (mtrG)

This Recombinant Methanocaldococcus jannaschii Tetrahydromethanopterin S-methyltransferase subunit G (mtrG) spans the amino acid sequence from region 1-84.

Product Specifications

Product Name Alternative

Tetrahydromethanopterin S-methyltransferase subunit G, EC= 2.1.1.86, N5-methyltetrahydromethanopterin--coenzyme M methyltransferase subunit G

UniProt

Q58263

Expression Region

1-84

Origin

Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSEDEKLPQVIMDPADYEALKKRLDELEKKVENTNAELFQLAGKKVGRDIGILYGLVIGI ILSYILPALIKIIQILSLKVLVQQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Canine Solute carrier family 46 member 3 (SLC46A3) ELISA Kit
GTR10357753 96 Well

Canine Solute carrier family 46 member 3 (SLC46A3) ELISA Kit

Sign In for Pricing
View Details
ATGL (F-7)
sc-365278 200 µg/mL

ATGL (F-7)

Sign In for Pricing
View Details
Artemin
M10-129-L1000 1000 µg

Artemin

Sign In for Pricing
View Details
Lysosome-associated membrane Glycoprotein 1 (LAMP1) Mouse ELISA Kit
E7925 96 Tests

Lysosome-associated membrane Glycoprotein 1 (LAMP1) Mouse ELISA Kit

Sign In for Pricing
View Details
Canine Hepcidin Antimicrobial Peptide ELISA Kit
GTR10438147-01 48 Well

Canine Hepcidin Antimicrobial Peptide ELISA Kit

Sign In for Pricing
View Details
Canine Hepcidin Antimicrobial Peptide ELISA Kit
GTR10438147-02 96 Well

Canine Hepcidin Antimicrobial Peptide ELISA Kit

Sign In for Pricing
View Details