Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Sulfolobus islandicus rod-shaped virus 1 Uncharacterized protein 84 (84)

This Recombinant Sulfolobus islandicus rod-shaped virus 1 Uncharacterized protein 84 (84) spans the amino acid sequence from region 1-84.

Product Specifications

Product Name Alternative

Uncharacterized protein 84

UniProt

Q8QL32

Expression Region

1-84

Origin

Sulfolobus islandicus rod-shaped virus 1 (SIRV-1) (Sulfolobus virus SIRV-1)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNYLRRKMKMSETTLVLTIISTTTTTLFAIIQLYLKIKQALKDAVKEIVNSELSNLKTEI EELKIKQDELSRQVEEIKRKLDQK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Eosinophil Peroxidase (AHE-1), CF568 conjugate, 0.1mg/mL
BNC681231-100 1x 100 µL

Eosinophil Peroxidase (AHE-1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MAGE A1 (MA454), CF488A conjugate, 0.1mg/mL
BNC880008-100 1x 100 µL

MAGE A1 (MA454), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (UCHL-1), CF647 conjugate, 0.1mg/mL
BNC470003-500 1x 500 µL

CD45RO (UCHL-1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 17 (E3), CF488A conjugate, 0.1mg/mL
BNC880158-100 1x 100 µL

Cytokeratin 17 (E3), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD34 (QBEnd/10 + HPCA1/763), CF488A conjugate, 0.1mg/mL
BNC880904-500 1x 500 µL

CD34 (QBEnd/10 + HPCA1/763), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RA (158-4D3), CF488A conjugate, 0.1mg/mL
BNC880028-500 1x 500 µL

CD45RA (158-4D3), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details