Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized protein ML1584 (ML1584)

This Recombinant Uncharacterized protein ML1584 (ML1584) spans the amino acid sequence from region 1-84.

Product Specifications

Product Name Alternative

Uncharacterized protein ML1584

UniProt

Q9CBU2

Expression Region

1-84

Origin

Mycobacterium leprae

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MASTEGEHNAGVDPAEVPSVAWGWSRINHHTWHIVGLFAIGLLLAMLRGNHIGHVENWYL IGFAALVFFVLIRDLLGRRRGWIR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ARHGEF10L Protein Vector (Mouse) (pPB-N-His)
PV155931 500 ng

ARHGEF10L Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
Lentiviral mouse Fezf1 shRNA (UAS) - Lentiviral mouseFezf1 shRNA (UAS, GFP) (25)
GTR15104792 1 Vial

Lentiviral mouse Fezf1 shRNA (UAS) - Lentiviral mouseFezf1 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
Mouse Intelectin 1 (ITLN1) Antibody Pair Kit (with Standard)
MBS2099677-01 5x 96 Tests

Mouse Intelectin 1 (ITLN1) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Mouse Intelectin 1 (ITLN1) Antibody Pair Kit (with Standard)
MBS2099677-02 5x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1,5x 96 Tests)

Mouse Intelectin 1 (ITLN1) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Mouse Intelectin 1 (ITLN1) Antibody Pair Kit (with Standard)
MBS2099677-03 10x 96 Tests

Mouse Intelectin 1 (ITLN1) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Mouse Intelectin 1 (ITLN1) Antibody Pair Kit (with Standard)
MBS2099677-04 10x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1, 10x 96 Tests)

Mouse Intelectin 1 (ITLN1) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details