Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized protein ML1584 (ML1584)

This Recombinant Uncharacterized protein ML1584 (ML1584) spans the amino acid sequence from region 1-84.

Product Specifications

Product Name Alternative

Uncharacterized protein ML1584

UniProt

Q9CBU2

Expression Region

1-84

Origin

Mycobacterium leprae

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MASTEGEHNAGVDPAEVPSVAWGWSRINHHTWHIVGLFAIGLLLAMLRGNHIGHVENWYL IGFAALVFFVLIRDLLGRRRGWIR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL17F (Interleukin-17F, IL-17F, Cytokine ML-1, Interleukin-24, IL-24, IL24) (MaxLight 550)
MBS6212058-01 0.1 mL

IL17F (Interleukin-17F, IL-17F, Cytokine ML-1, Interleukin-24, IL-24, IL24) (MaxLight 550)

Sign In for Pricing
View Details
IL17F (Interleukin-17F, IL-17F, Cytokine ML-1, Interleukin-24, IL-24, IL24) (MaxLight 550)
MBS6212058-02 5x 0.1 mL

IL17F (Interleukin-17F, IL-17F, Cytokine ML-1, Interleukin-24, IL-24, IL24) (MaxLight 550)

Sign In for Pricing
View Details
Muffle Box Furnace (BER-3318)
BER-3318 1 Unit

Muffle Box Furnace (BER-3318)

Sign In for Pricing
View Details
PDGFRA, phosphorylated (pY762) (Azide free) (HRP) discontinued
039822-HRP 200 µL

PDGFRA, phosphorylated (pY762) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details
FTO peptide
orb218639-01 1 mg

FTO peptide

Sign In for Pricing
View Details
FTO peptide
orb218639-02 5 mg

FTO peptide

Sign In for Pricing
View Details