Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized protein ML1584 (ML1584)

This Recombinant Uncharacterized protein ML1584 (ML1584) spans the amino acid sequence from region 1-84.

Product Specifications

Product Name Alternative

Uncharacterized protein ML1584

UniProt

Q9CBU2

Expression Region

1-84

Origin

Mycobacterium leprae

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MASTEGEHNAGVDPAEVPSVAWGWSRINHHTWHIVGLFAIGLLLAMLRGNHIGHVENWYL IGFAALVFFVLIRDLLGRRRGWIR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

STX6 Antibody (HRP)
orb242360-01 50 µg

STX6 Antibody (HRP)

Sign In for Pricing
View Details
STX6 Antibody (HRP)
orb242360-02 100 µg

STX6 Antibody (HRP)

Sign In for Pricing
View Details
Monkey Tumor Associated Glycoprotein 72 ELISA Kit
MBS092811-01 48 Well

Monkey Tumor Associated Glycoprotein 72 ELISA Kit

Sign In for Pricing
View Details
Monkey Tumor Associated Glycoprotein 72 ELISA Kit
MBS092811-02 96 Well

Monkey Tumor Associated Glycoprotein 72 ELISA Kit

Sign In for Pricing
View Details
Monkey Tumor Associated Glycoprotein 72 ELISA Kit
MBS092811-03 5x 96 Well

Monkey Tumor Associated Glycoprotein 72 ELISA Kit

Sign In for Pricing
View Details
Monkey Tumor Associated Glycoprotein 72 ELISA Kit
MBS092811-04 10x 96 Well

Monkey Tumor Associated Glycoprotein 72 ELISA Kit

Sign In for Pricing
View Details