Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cytochrome b559 subunit alpha (psbE)

This Recombinant Cytochrome b559 subunit alpha (psbE) spans the amino acid sequence from region 1-84.

Product Specifications

Product Name Alternative

Cytochrome b559 subunit alpha, PSII reaction center subunit V

UniProt

Q9TM20

Expression Region

1-84

Origin

Cyanidium caldarium

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSGGSTGERPFSDIITSVRYWVIHSITIPSLFIAGWLFVSTGLAYDVFGTPRPNEYFSEN RQQVPLINDRFNAREELDDLTSNL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

pLV3-U6-Sting1-sgRNA1-CAS9-EGFP-Puro Plasmid
PVT63106 2 µg

pLV3-U6-Sting1-sgRNA1-CAS9-EGFP-Puro Plasmid

Sign In for Pricing
View Details
Porcine Cingulin like protein 1 (CGNL1) ELISA Kit
GTR10316457 96 Well

Porcine Cingulin like protein 1 (CGNL1) ELISA Kit

Sign In for Pricing
View Details
Recombinant Nostoc punctiforme UDP-N-acetylmuramoylalanine--D-glutamate ligase (murD)
MBS1063780-01 0.02 mg (E-Coli)

Recombinant Nostoc punctiforme UDP-N-acetylmuramoylalanine--D-glutamate ligase (murD)

Sign In for Pricing
View Details
Recombinant Nostoc punctiforme UDP-N-acetylmuramoylalanine--D-glutamate ligase (murD)
MBS1063780-02 0.02 mg (Yeast)

Recombinant Nostoc punctiforme UDP-N-acetylmuramoylalanine--D-glutamate ligase (murD)

Sign In for Pricing
View Details
Recombinant Nostoc punctiforme UDP-N-acetylmuramoylalanine--D-glutamate ligase (murD)
MBS1063780-03 0.1 mg (E-Coli)

Recombinant Nostoc punctiforme UDP-N-acetylmuramoylalanine--D-glutamate ligase (murD)

Sign In for Pricing
View Details
Recombinant Nostoc punctiforme UDP-N-acetylmuramoylalanine--D-glutamate ligase (murD)
MBS1063780-04 0.1 mg (Yeast)

Recombinant Nostoc punctiforme UDP-N-acetylmuramoylalanine--D-glutamate ligase (murD)

Sign In for Pricing
View Details