Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cytochrome b559 subunit alpha (psbE)

This Recombinant Cytochrome b559 subunit alpha (psbE) spans the amino acid sequence from region 1-84.

Product Specifications

Product Name Alternative

Cytochrome b559 subunit alpha, PSII reaction center subunit V

UniProt

Q9TM20

Expression Region

1-84

Origin

Cyanidium caldarium

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSGGSTGERPFSDIITSVRYWVIHSITIPSLFIAGWLFVSTGLAYDVFGTPRPNEYFSEN RQQVPLINDRFNAREELDDLTSNL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF354A Adenovirus (Human)
51471051 1.0 mL

ZNF354A Adenovirus (Human)

Sign In for Pricing
View Details
ARSH Polyclonal Antibody, PE-Cy7 Conjugated
bs-9101R-PE-Cy7 100 µL

ARSH Polyclonal Antibody, PE-Cy7 Conjugated

Sign In for Pricing
View Details
BC006779 Protein Vector (Mouse) (pPM-C-HA)
13067024 500 ng

BC006779 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Mouse Matrix Metalloproteinase 23 (MMP23) ELISA Kit
abx573260 96 Tests

Mouse Matrix Metalloproteinase 23 (MMP23) ELISA Kit

Sign In for Pricing
View Details
2,4-Dinitrophenyl 2-deoxy-2-fluoro-b-D-glucopyranoside
GC7368-2mg 2 mg

2,4-Dinitrophenyl 2-deoxy-2-fluoro-b-D-glucopyranoside

Sign In for Pricing
View Details
DANAGENE Plasmid Miniprep "Transfection Grade" Kit
0702.3 250 miniPreparations

DANAGENE Plasmid Miniprep "Transfection Grade" Kit

Sign In for Pricing
View Details