Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cytochrome b559 subunit alpha (psbE)

This Recombinant Cytochrome b559 subunit alpha (psbE) spans the amino acid sequence from region 1-84.

Product Specifications

Product Name Alternative

Cytochrome b559 subunit alpha, PSII reaction center subunit V

UniProt

Q9TM20

Expression Region

1-84

Origin

Cyanidium caldarium

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSGGSTGERPFSDIITSVRYWVIHSITIPSLFIAGWLFVSTGLAYDVFGTPRPNEYFSEN RQQVPLINDRFNAREELDDLTSNL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal ID1 Antibody (PCRP-ID1-2F11) [DyLight 755]
NBP3-14075IR 0.1 mL

Mouse Monoclonal ID1 Antibody (PCRP-ID1-2F11) [DyLight 755]

Sign In for Pricing
View Details
BALB/3T3 clone A31 Cell Lines Complete Growth Medium 500ML
IBALB3T3CA31CLCGM500ML 500 mL

BALB/3T3 clone A31 Cell Lines Complete Growth Medium 500ML

Sign In for Pricing
View Details
Rabbit Anti-N-epsilon-CML Polyclonal Antibody
STA-014 100 µg

Rabbit Anti-N-epsilon-CML Polyclonal Antibody

Sign In for Pricing
View Details
MrgprX2 antagonist-2
orb1690712 5 mg

MrgprX2 antagonist-2

Sign In for Pricing
View Details
BCAS4 Rabbit Polyclonal Antibody (BF405)
orb2553584 100 µL

BCAS4 Rabbit Polyclonal Antibody (BF405)

Sign In for Pricing
View Details
ANGPTL7 Polyclonal Antibody, Biotin Conjugated
A50036-100 100 µL

ANGPTL7 Polyclonal Antibody, Biotin Conjugated

Sign In for Pricing
View Details