Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Amphiregulin (AREG)

This Recombinant Human Amphiregulin (AREG) spans the amino acid sequence from region 101-184.

Product Specifications

Product Name Alternative

Amphiregulin, AR, Colorectum cell-derived growth factor, CRDGF

UniProt

P15514

Expression Region

101-184

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

SVRVEQVVKPPQNKTESENTSDKPKRKKKGGKNGKNRRNRKKKNPCNAEFQNFCIHGECK YIEHLEAVTCKCQQEYFGERCGEK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Feline IL-4 protein
orb1215680 10 µg

Feline IL-4 protein

Sign In for Pricing
View Details
Recombinant Vibrio fischeri UPF0325 protein VF_1965 (VF_1965)
MBS1335771-01 0.02 mg (E-Coli)

Recombinant Vibrio fischeri UPF0325 protein VF_1965 (VF_1965)

Sign In for Pricing
View Details
Recombinant Vibrio fischeri UPF0325 protein VF_1965 (VF_1965)
MBS1335771-02 0.1 mg (E-Coli)

Recombinant Vibrio fischeri UPF0325 protein VF_1965 (VF_1965)

Sign In for Pricing
View Details
Recombinant Vibrio fischeri UPF0325 protein VF_1965 (VF_1965)
MBS1335771-03 0.02 mg (Yeast)

Recombinant Vibrio fischeri UPF0325 protein VF_1965 (VF_1965)

Sign In for Pricing
View Details
Recombinant Vibrio fischeri UPF0325 protein VF_1965 (VF_1965)
MBS1335771-04 0.1 mg (Yeast)

Recombinant Vibrio fischeri UPF0325 protein VF_1965 (VF_1965)

Sign In for Pricing
View Details
Recombinant Vibrio fischeri UPF0325 protein VF_1965 (VF_1965)
MBS1335771-05 0.02 mg (Baculovirus)

Recombinant Vibrio fischeri UPF0325 protein VF_1965 (VF_1965)

Sign In for Pricing
View Details