Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Danio rerio Protein TRIQK (triqk)

This Recombinant Danio rerio Protein TRIQK (triqk) spans the amino acid sequence from region 1-84.

Product Specifications

Product Name Alternative

Protein TRIQK, Triple repetitive-sequence of QXXK/R protein homolog

UniProt

A5WVU9

Expression Region

1-84

Origin

Danio rerio (Zebrafish) (Brachydanio rerio)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGKKDASSVKLPVDQYRKQIGKQDYKKTKPVLRATRLKAEAKRSAPGIRDIILVIVAVLL FLLGVYAFFYLNLSTELDLDVDMD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Amyloid Polypeptide (IAPP) ELISA Kit
MBS264061-01 48 Well

Rat Amyloid Polypeptide (IAPP) ELISA Kit

Sign In for Pricing
View Details
Rat Amyloid Polypeptide (IAPP) ELISA Kit
MBS264061-02 96 Well

Rat Amyloid Polypeptide (IAPP) ELISA Kit

Sign In for Pricing
View Details
Rat Amyloid Polypeptide (IAPP) ELISA Kit
MBS264061-03 5x 96 Well

Rat Amyloid Polypeptide (IAPP) ELISA Kit

Sign In for Pricing
View Details
Rat Amyloid Polypeptide (IAPP) ELISA Kit
MBS264061-04 10x 96 Well

Rat Amyloid Polypeptide (IAPP) ELISA Kit

Sign In for Pricing
View Details
IL-6 (Interleukin 6) Chicken ELISA Kit
E2227 96 Tests

IL-6 (Interleukin 6) Chicken ELISA Kit

Sign In for Pricing
View Details
FNDC5 Polyclonal Antibody, AbBy Fluor™ 594 Conjugated
bs-8486R-BF594-01 20 µL

FNDC5 Polyclonal Antibody, AbBy Fluor™ 594 Conjugated

Sign In for Pricing
View Details