Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Danio rerio Protein TRIQK (triqk)

This Recombinant Danio rerio Protein TRIQK (triqk) spans the amino acid sequence from region 1-84.

Product Specifications

Product Name Alternative

Protein TRIQK, Triple repetitive-sequence of QXXK/R protein homolog

UniProt

A5WVU9

Expression Region

1-84

Origin

Danio rerio (Zebrafish) (Brachydanio rerio)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGKKDASSVKLPVDQYRKQIGKQDYKKTKPVLRATRLKAEAKRSAPGIRDIILVIVAVLL FLLGVYAFFYLNLSTELDLDVDMD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ADAR1 Rabbit Monoclonal Antibody
AMRe86950-01 1 Each

ADAR1 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
ADAR1 Rabbit Monoclonal Antibody
AMRe86950-02 50 µL

ADAR1 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
ADAR1 Rabbit Monoclonal Antibody
AMRe86950-03 100 µL

ADAR1 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
SSX4, ID (SSX4, SSX4A, Protein SSX4, Cancer/testis antigen 5.4) (MaxLight 650) discontinued
042340-ML650 100 µL

SSX4, ID (SSX4, SSX4A, Protein SSX4, Cancer/testis antigen 5.4) (MaxLight 650) discontinued

Sign In for Pricing
View Details
Dapson 10mM * 1mL in DMSO
A16168-10mM-D 10 mM x 1mL in DMSO

Dapson 10mM * 1mL in DMSO

Sign In for Pricing
View Details
Mouse Tmem161a qPCR Primer Pair
QM60882S 200 Tests

Mouse Tmem161a qPCR Primer Pair

Sign In for Pricing
View Details