Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Danio rerio Protein TRIQK (triqk)

This Recombinant Danio rerio Protein TRIQK (triqk) spans the amino acid sequence from region 1-84.

Product Specifications

Product Name Alternative

Protein TRIQK, Triple repetitive-sequence of QXXK/R protein homolog

UniProt

A5WVU9

Expression Region

1-84

Origin

Danio rerio (Zebrafish) (Brachydanio rerio)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGKKDASSVKLPVDQYRKQIGKQDYKKTKPVLRATRLKAEAKRSAPGIRDIILVIVAVLL FLLGVYAFFYLNLSTELDLDVDMD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Cenpi (NM_145924) AAV Particle
MR218684A1V 250 µL

Mouse Cenpi (NM_145924) AAV Particle

Sign In for Pricing
View Details
Rabbit Anti-Human SulF2 pAb
PA16794-01 50 μL

Rabbit Anti-Human SulF2 pAb

Sign In for Pricing
View Details
Rabbit Anti-Human SulF2 pAb
PA16794-02 100 μL

Rabbit Anti-Human SulF2 pAb

Sign In for Pricing
View Details
pDNR-LIB-NAA20 Plasmid
PVT27142 2 µg

pDNR-LIB-NAA20 Plasmid

Sign In for Pricing
View Details
ABCF2 discontinued
532628-01 30ul

ABCF2 discontinued

Sign In for Pricing
View Details
ABCF2 discontinued
532628-02 100 µL

ABCF2 discontinued

Sign In for Pricing
View Details