Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Xenopus laevis Protein TRIQK (triqk)

This Recombinant Xenopus laevis Protein TRIQK (triqk) spans the amino acid sequence from region 1-84.

Product Specifications

Product Name Alternative

Protein TRIQK, Triple repetitive-sequence of QXXK/R protein

UniProt

B2B9D9

Expression Region

1-84

Origin

Xenopus laevis (African clawed frog)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGKKDASTTRTPVDQYRKQIGRQDYKKNKPVLKATRLKAEAKKAAIGIKEVILVTIAILV LLFAFYAFFFLNLTKTDIYEDSNN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C16orf78 Protein Lysate (Human) with C-Ha Tag
13941031 100 µg

C16orf78 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
Rat Prss8 / Prostasin Recombinant Protein
R12535r 1 Each

Rat Prss8 / Prostasin Recombinant Protein

Sign In for Pricing
View Details
MAGB6 Antibody
E19-10037-2 100 µg -100 µL

MAGB6 Antibody

Sign In for Pricing
View Details
GADD 45γ CRISPR/Cas9 KO Plasmid (m)
sc-423879 20 µg

GADD 45γ CRISPR/Cas9 KO Plasmid (m)

Sign In for Pricing
View Details
RHBDD2 Antibody
254191 0.1 mg

RHBDD2 Antibody

Sign In for Pricing
View Details
KANSL3 Rabbit pAb (APR28057N)
APR28057N-01 50 µL

KANSL3 Rabbit pAb (APR28057N)

Sign In for Pricing
View Details