Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Xenopus laevis Protein TRIQK (triqk)

This Recombinant Xenopus laevis Protein TRIQK (triqk) spans the amino acid sequence from region 1-84.

Product Specifications

Product Name Alternative

Protein TRIQK, Triple repetitive-sequence of QXXK/R protein

UniProt

B2B9D9

Expression Region

1-84

Origin

Xenopus laevis (African clawed frog)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGKKDASTTRTPVDQYRKQIGRQDYKKNKPVLKATRLKAEAKKAAIGIKEVILVTIAILV LLFAFYAFFFLNLTKTDIYEDSNN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monkey TGFb3 ELISA Kit
EMKT0175 96 Tests

Monkey TGFb3 ELISA Kit

Sign In for Pricing
View Details
Rat Aldolase A, Fructose Bisphosphate ELISA Kit (ALDOA)
RK03483 96 Tests

Rat Aldolase A, Fructose Bisphosphate ELISA Kit (ALDOA)

Sign In for Pricing
View Details
SLC35D3 (NM_001008783) Human Tagged Lenti ORF Clone
RC210345L4 10 µg

SLC35D3 (NM_001008783) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
WIPI1 Antibody
orb1313421-01 30 µL

WIPI1 Antibody

Sign In for Pricing
View Details
WIPI1 Antibody
orb1313421-02 50 μL

WIPI1 Antibody

Sign In for Pricing
View Details
WIPI1 Antibody
orb1313421-03 100 µL

WIPI1 Antibody

Sign In for Pricing
View Details