Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Xenopus laevis Protein TRIQK (triqk)

This Recombinant Xenopus laevis Protein TRIQK (triqk) spans the amino acid sequence from region 1-84.

Product Specifications

Product Name Alternative

Protein TRIQK, Triple repetitive-sequence of QXXK/R protein

UniProt

B2B9D9

Expression Region

1-84

Origin

Xenopus laevis (African clawed frog)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGKKDASTTRTPVDQYRKQIGRQDYKKNKPVLKATRLKAEAKKAAIGIKEVILVTIAILV LLFAFYAFFFLNLTKTDIYEDSNN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

WO-28-NL Inspection & Calibration Labels
235044 350 Pack (14 Label (s) x 25 Card)

WO-28-NL Inspection & Calibration Labels

Sign In for Pricing
View Details
Recombinant Human TM9SF2 Protein - (Dry Ice)
H00009375-Q01-25ug 25 µg

Recombinant Human TM9SF2 Protein - (Dry Ice)

Sign In for Pricing
View Details
PION CRISPRa sgRNA lentivector (set of three targets)(Rat)
36706126 3x 1.0µg DNA

PION CRISPRa sgRNA lentivector (set of three targets)(Rat)

Sign In for Pricing
View Details
EGF Receptor (D38B1) XP® Rabbit Monoclonal Antibody (BSA and Azide Free)
CST 26038SF 100 µg

EGF Receptor (D38B1) XP® Rabbit Monoclonal Antibody (BSA and Azide Free)

Sign In for Pricing
View Details
RARRES2 Human, His
OM305769-01 5 µg

RARRES2 Human, His

Sign In for Pricing
View Details
RARRES2 Human, His
OM305769-02 25 µg

RARRES2 Human, His

Sign In for Pricing
View Details