Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Xenopus laevis Protein TRIQK (triqk)

This Recombinant Xenopus laevis Protein TRIQK (triqk) spans the amino acid sequence from region 1-84.

Product Specifications

Product Name Alternative

Protein TRIQK, Triple repetitive-sequence of QXXK/R protein

UniProt

B2B9D9

Expression Region

1-84

Origin

Xenopus laevis (African clawed frog)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGKKDASTTRTPVDQYRKQIGRQDYKKNKPVLKATRLKAEAKKAAIGIKEVILVTIAILV LLFAFYAFFFLNLTKTDIYEDSNN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PerCP-Cy5.5 anti-mouse CD197 (CCR7)
E16FMS197-025U 25 µg

PerCP-Cy5.5 anti-mouse CD197 (CCR7)

Sign In for Pricing
View Details
Trappc2 Antibody - N-terminal region
ARP50567_P050-25UL 25 µL

Trappc2 Antibody - N-terminal region

Sign In for Pricing
View Details
Recombinant Human Flt-3/Flk-2 Fc Chimera Avi-tag Protein CF
AVI11064-050 50 µg

Recombinant Human Flt-3/Flk-2 Fc Chimera Avi-tag Protein CF

Sign In for Pricing
View Details
PADI2 Rabbit pAb
E45R18901N-100 100 µL

PADI2 Rabbit pAb

Sign In for Pricing
View Details
Inhibitor of Nuclear Factor kappa-B Kinase subunit epsilon (IKBKE) Human ELISA Kit
E2666 96 Tests

Inhibitor of Nuclear Factor kappa-B Kinase subunit epsilon (IKBKE) Human ELISA Kit

Sign In for Pricing
View Details
EZ-Methylation Magprep Beads (16 mL)
D4100-5-16 16 mL

EZ-Methylation Magprep Beads (16 mL)

Sign In for Pricing
View Details