Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Xenopus laevis Protein TRIQK (triqk)

This Recombinant Xenopus laevis Protein TRIQK (triqk) spans the amino acid sequence from region 1-84.

Product Specifications

Product Name Alternative

Protein TRIQK, Triple repetitive-sequence of QXXK/R protein

UniProt

B2B9D9

Expression Region

1-84

Origin

Xenopus laevis (African clawed frog)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGKKDASTTRTPVDQYRKQIGRQDYKKNKPVLKATRLKAEAKKAAIGIKEVILVTIAILV LLFAFYAFFFLNLTKTDIYEDSNN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RFXANK (NM_001278728) Human Tagged ORF Clone
RG236810 10 µg

RFXANK (NM_001278728) Human Tagged ORF Clone

Sign In for Pricing
View Details
SLC19A2 Human qPCR Primer Pair (NM_006996)
HP209818 200 Reactions

SLC19A2 Human qPCR Primer Pair (NM_006996)

Sign In for Pricing
View Details
CUL-1 (AS97) Alexa Fluor® 488
sc-12761 AF488 200 µg/mL

CUL-1 (AS97) Alexa Fluor® 488

Sign In for Pricing
View Details
Human Mitf (Microphthalmia Associated Transcription Factor) ELISA Kit
FY-EH3090 96 Well

Human Mitf (Microphthalmia Associated Transcription Factor) ELISA Kit

Sign In for Pricing
View Details
Rapgef1-set siRNA/shRNA/RNAi Lentivector (Mouse)
38504094 4x 500 ng

Rapgef1-set siRNA/shRNA/RNAi Lentivector (Mouse)

Sign In for Pricing
View Details
IGKV2-28 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K1055706 1.0 µg DNA

IGKV2-28 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details