Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine coronavirus Envelope small membrane protein (E)

This Recombinant Bovine coronavirus Envelope small membrane protein (E) spans the amino acid sequence from region 1-84.

Product Specifications

Product Name Alternative

Envelope small membrane protein, E protein, sM protein

UniProt

P0C2Q2

Expression Region

1-84

Origin

Bovine coronavirus (strain LSU-94LSS-051) (BCoV-LSU) (BCV)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFMADAYFADTVWYVGQIIFIVAICLLVIIVVVAFLATFKLCIQLCGMCNTLVLSPSIYV FNRGRQFYEFYNDVKPPVLDVDDV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Breast
CS639784 5x 5 µm

Frozen Tissue Sections, Breast

Sign In for Pricing
View Details
PPAR delta (PPARD) (430-441) Goat Polyclonal Antibody
AP23032PU-N 50 µg

PPAR delta (PPARD) (430-441) Goat Polyclonal Antibody

Sign In for Pricing
View Details
PAICS (NM_001079524) Human Over-expression Lysate
LC421514 20 µg

PAICS (NM_001079524) Human Over-expression Lysate

Sign In for Pricing
View Details
Peramine Hemisulfate
TRC-P285300-10MG 10 mg

Peramine Hemisulfate

Sign In for Pricing
View Details
2-Naphthylacetonitrile
TRC-N377810-500MG 500 mg

2-Naphthylacetonitrile

Sign In for Pricing
View Details
Recombinant Villin Antibody
RC-15767-01 50 μL

Recombinant Villin Antibody

Sign In for Pricing
View Details